Origin: Recombinant | Cat. No.: 42750 |
Tag: No tag | Size: 0.1 mg |
Source: E.coli | Purity: >90% |
Other names: IL-33 | Species: Human |
Introduction
IL-33 was identified based on sequence and structural homology with IL-1 family cytokines. The N-terminal portion of full length IL-33 contains a predicted bipartite nuclear localization sequence and a homeodomain-like helix-turn-helix DNA binding domain. The C-
terminal fragment, corresponding to mature IL-33, binds and triggers signaling through mast cell IL-1 R4/ST2L, a longtime orphan
receptor involved in the augmentation of Th2 cell responses. A ternary signaling complex is formed by the subsequent association of IL-33 and ST2L with IL-1R AcP. Stimulation of Th2 polarized lymphocytes with mature IL-33 in vitro induces IL-5 and IL-13 secretion. In vivo administration of mature IL-33 promotes increased production of IL-5, IL-13, IgE, and IgA, as well as splenomegaly and
inflammatory infiltration of mucosal tissues.
Description
Expressed in E.coli with total 167 AA. Mw: 18.81 KDa (calculated).
No tag, but with 2 extra AA at N-terminal (highlighted).
Recombinant antigen for research use or manufacturing only.
Amino Acid Sequence
GASITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMETLMETVTLSP
TKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMETHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
Formulation
Lyophilized at 1 mg/mL in NaCl 500mM, KCl 2.7mM, Na2HPO4 10mM, KH2PO4 1.8mM, pH 7.0.
Reconstitution
Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolves completely.
Storage
Store lyophilized protein at -20°C. Aliquot reconstituted protein and store at -80°C. Avoid repeated freezing/thawing cycles.
Quality Control Test
BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.
Application
ELISA and Western Blotting.
Endotoxin Level
<0.2 EU per 1 μg of the protein by the LAL method.
