Origin: Recombinant |
|
|
|
|
|
|
|
N-terminal pro-brain (or B-type) natriuretic peptide (NT-proBNP) is produced predominately by the cardiac ventricular myocytes. NT-proBNP is released in response to volume expansion and filling pressure and is involved in maintaining intravascular volume
homeostasis. Elevated plasma levels of BNP and NT-proBNP have been observed at times of cardiac stress and damage.
Description
Expressed in E.coli with total 112 AA. Mw: 12.6 KDa (calculated).
N-terminal 6xHis-tag and TEV cleavage site, 36 extra AA (highlighted).
Recombinant antigen for research use or manufacturing only.
Amino Acid Sequence
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQ
VEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR
Formulation
Lyophilized at 1 mg/mL in PBS.
Reconstitution
Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolves completely.
Storage
Store lyophilized protein at -20°C. Aliquot reconstituted protein and store at -80°C. Avoid repeated freezing/thawing cycles.
Quality Control Test
BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.
Application
Standard ELISA test, Western Blot.
Endotoxin Level
<0.2 EU/μg
