Cat. No.: 41520 | Other Names: U1-snRNPC, RNPC, RNP-C |
Species: Human | Size: 0.1mg |
Origin: Recombinant | Tag: N-terminal 6xHis |
Source: Spodoptera frugiperda Sf9 | Purity: >90% |
Introduction
Small nuclear ribonucleoprotein complexes (abbreviated as U-snRNP) are essential for splicing of precursor mRNA molecules.
U1-snRNP is the most abundant RNP particle in the nucleus and consists of one small uridylate-rich RNA (U1 RNA) complexed with several proteins, and the three 68/70 kDa (snRNP68/70), A polypeptides (snRNPA) and C polypeptides (snRNPC) are unique to the U1-snRNP particle.
Autoantibodies to U1-snRNP are present in 95% of patients with Mixed Connective Tissue Disease (MCTD) and 30% of patients
with SLE.
Immunological Function
As an autoantigen, RNP-C binds with IgG-type human auto-antibodies.
Amino Acid Sequence
MSYYHHHHHHDYDIPTTENLYFQGAPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSL
IDKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGM
RPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR
Applications
Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.
Formulation
Liquid in storage buffer (50mM Tris, 300-500mM NaCl, 10% Glycerol, Protease inhibitor, pH8.0).
Description
Expressed in insect Sf9 cells with a total of 183 AA.
Mw: 20.4 KDa (calculated).
N-terminal 6xHis-tag and TEV cleavage site, 25 extra AA (highlighted).
Recombinant antigen for research use or manufacturing only.
Storage
Store at –80°C. Avoid repeated freezing /thawing cycles.
Quality Control Test
BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.