Cat. No.: 41610 | Other Names: CENP-A, CENP A |
Species: Human | Size: 0.1mg |
Origin: Recombinant | Tag: N-terminal 6xHis |
Source: Spodoptera frugiperda Sf9 | Purity: >95% |
Introduction
Centromere proteins are a group of proteins which form and/or mediate the function of centromeres, the central structures of
chromosomes to which spindle fibers/microtubuli attach and pull the chromosomes apart in cell division. The centromere
protein A (CENPA) is one of them. CENPA contains a histone H3 related histone fold domain and can be incorporated into
centromeric chromatin due to its histone-like properties. Anti-CENPA autoantibodies are an important marker for diagnosis of
Scleroderma / CREST syndrome.
Immunological Function
As an autoantigen, CENP-A binds with IgG-type human auto-antibodies.
Amino Acid Sequence
MSYYHHHHHHDYDIPTTENLYFQGAGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG
Applications
Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.
Formulation
Liquid in 8M Urea buffer (pH 8.0).
Description
Expressed in insect Sf9 cells with a total of 164 AA.
Mw: 19.0 KDa (calculated).
N-terminal 6xHis-tag and TEV cleavage site, 25 extra AA (highlighted).
Recombinant antigen for research use or manufacturing only.
Storage
Store at –80°C. Avoid repeated freezing /thawing cycles.
Quality Control Test
BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.