Cat. No.: 41A072 | Other Names: OGDC-E2, DLST |
Species: Human | Size: 0.1mg |
Origin: Recombinant | Tag: N-terminal 6xHis |
Source: Spodoptera frugiperda Sf9 | Purity: >90% |
Introduction
OGDC-E2 is the central E2 component of 2-oxoglutarate dehydrogenase complex (OGDC), which is a mitochondrial multienzyme
complex involved in the maintenance of the cellular redox state. Patients with primary biliary cirrhosis show autoantibodies against
the E2 component of 2-oxoglutarate dehydrogenase complex.
Immunological Function
As an autoantigen, OGDC-E2 binds with IgG-type human auto-antibodies.
Amino Acid Sequence
MSYYHHHHHHDYDIPTTENLYFQGADDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
Applications
Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.
Formulation
Liquid in storage buffer (50mM Tris, 300mM NaCl, 0.4M L-Arginine, Protease inhibitor, pH8.0).
Description
Expressed in insect Sf9 cells with a total of 411 AA.
Mw: 44.5 KDa (calculated).
N-terminal 6xHis-tag and TEV cleavage site, 25 extra AA (highlighted).
Recombinant antigen for research use or manufacturing only.
Storage
Store at –80°C. Avoid repeated freezing /thawing cycles.
Quality Control Test
BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.