Cat. No.: 41A262 | Other Names: LKM-1, CYP2D6 |
Species: Human | Size: 0.1mg |
Origin: Recombinant | Tag: N-terminal 6xHis |
Source: Spodoptera frugiperda Sf9 | Purity: >80% |
Introduction
Cytochrome p450 2D6 is a cytochrome p450 mono-oxygenase that is primarily expressed in the liver and identical with the so-called
liver-kidney microsome 1 (LKM-1) antigen. This enzyme localizes to the endoplasmic reticulum and is involved in the detoxification of xenobiotic substances and responsible for the metabolism of many drugs and environmental chemicals that it oxidizes. As the
conventional serological repertoire for the diagnosis of AIH, CYP2D6has a prevalence of around 70% in AIH Type 2.
Immunological Function
As an autoantigen, LKM-1 binds with IgG-type human auto-antibodies.
Amino Acid Sequence
MSYYHHHHHHDYDIPTTENLYFQGAGLEALVPLAVIVAIFLLLVDLMHRRQRWAARYPPGPLPLPGLGNLLHVDFQNTPYCFDQLRRRFGDVFSLQLAWTPVVVLNGLAAVREALVTHGEDTADRPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLEQWVTEEAACLCAAFANHSGRPFRPNGLLDKAVSNVIASLTCGRRFEYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAEMEKAKGNPESSFNDENLRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSPSPYELCAVPR
Applications
Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.
Formulation
Liquid in storage buffer (8M Urea, 10mM Tris, 50mM Na2HPO4, 1% SDS, pH8.0).
Description
Expressed in insect Sf9 cells with a total of 521 AA.
Mw: 58.7 KDa (calculated).
N-terminal 6xHis-tag and TEV cleavage site, 25 extra AA (highlighted).
Recombinant antigen for research use or manufacturing only.
Storage
Store at –20°C. Avoid repeated freezing /thawing cycles.
Quality Control Test
BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.
Immunodot analysis to determine functionality of protein.